SCOPe 2.08: Domain d3rpib2: 3rpi B:97-202

Lineage for d3rpib2 (3rpi B:97-202)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3rpib2: 3rpi B:97-202 [215970]
   Other proteins in same PDB: d3rpia_, d3rpib1, d3rpih_, d3rpil1
   automated match to d1rhha2
   complexed with nag

Details for d3rpib2

PDB Entry: 3rpi, 2.65 Å

PDB Description: crystal structure of fab from 3bnc60, highly potent anti-hiv antibody

PDB Compounds: (B:) Light chain from highly potent anti-HIV neutralizing antibody

SCOPe Domain Sequences for d3rpib2:

Sequence; same for both SEQRES and ATOM records:

>d3rpib2 b.1.1.2 (B:97-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d3rpib2:

• d3rpib2 first appeared in SCOPe 2.03
  
• d3rpib2 appears in SCOPe 2.07