SCOPe 2.02: Domain d1dlha1: 1dlh A:82-182

Lineage for d1dlha1 (1dlh A:82-182)

Root: SCOPe 2.02
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
Uniprot P01903 28-207
probably orthologous to the mouse I-E group
Domain d1dlha1: 1dlh A:82-182 [21597]
Other proteins in same PDB: d1dlha2, d1dlhb1, d1dlhb2, d1dlhd2, d1dlhe1, d1dlhe2
complexed with nag, ndg

Details for d1dlha1

PDB Entry: 1dlh (more details), 2.8 Å

PDB Description: crystal structure of the human class ii mhc protein hla-dr1 complexed with an influenza virus peptide

PDB Compounds: (A:) class II histocompatibility antigen (hla-dr1) (alpha chain)

SCOPe Domain Sequences for d1dlha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlha1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefda

SCOPe Domain Coordinates for d1dlha1:

Click to download the PDB-style file with coordinates for d1dlha1.
(The format of our PDB-style files is described here.)

Timeline for d1dlha1: