SCOPe 2.08: Domain d3rpib1: 3rpi B:3-96

Lineage for d3rpib1 (3rpi B:3-96)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d3rpib1: 3rpi B:3-96 [215969]
   Other proteins in same PDB: d3rpib2, d3rpil2
   automated match to d1rhha1
   complexed with nag

Details for d3rpib1

PDB Entry: 3rpi, 2.65 Å

PDB Description: crystal structure of fab from 3bnc60, highly potent anti-hiv antibody

PDB Compounds: (B:) Light chain from highly potent anti-HIV neutralizing antibody

SCOPe Domain Sequences for d3rpib1:

Sequence; same for both SEQRES and ATOM records:

>d3rpib1 b.1.1.0 (B:3-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qmtqspsslsarvgdtvtitcqangylnwyqqrrgkapklliydgsklergvparfsgrr
wgqeynltinnlqpedvatyfcqvyefivpgtrldlk

Timeline for d3rpib1:

• d3rpib1 first appeared in SCOPe 2.03
  
• d3rpib1 appears in SCOPe 2.07