Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily) 3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest |
Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families) possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain) |
Family c.104.1.0: automated matches [227138] (1 protein) not a true family |
Protein automated matches [226840] (1 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224913] (8 PDB entries) |
Domain d3roza_: 3roz A: [215968] automated match to d1jzta_ complexed with nca, so4 |
PDB Entry: 3roz (more details), 2.8 Å
SCOPe Domain Sequences for d3roza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3roza_ c.104.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avkylsqeeaqavdqelfneyqfsvdqlmelaglscataiakaypptsmskspptvlvic gpgnnggdglvcarhlklfgyqptiyypkrpnkplftglvtqcqkmdipflgemppepmm vdelyelvvdaifgfsfkgdvrepfhsilsvlsgltvpiasidipsgwdvekgnpsgiqp dllisltapkksathftgryhylggrfvppalekkyqlnlpsypdtecvyrlq
Timeline for d3roza_: