SCOPe 2.04: Domain d3roub1: 3rou B:8-137

Lineage for d3roub1 (3rou B:8-137)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species)

7. Species Escherichia coli [TaxId:562] [51212] (30 PDB entries)

8. Domain d3roub1: 3rou B:8-137 [215964]
   Other proteins in same PDB: d3roua2, d3roub2
   automated match to d1g6na2
   complexed with cmp

Details for d3roub1

PDB Entry: 3rou, 2.1 Å

PDB Description: domain-domain flexibility leads to allostery within the camp receptor protein (crp)

PDB Compounds: (B:) Catabolite gene activator

SCOPe Domain Sequences for d3roub1:

Sequence; same for both SEQRES and ATOM records:

>d3roub1 b.82.3.2 (B:8-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilfylnqg
dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
sekvgnlafl

Timeline for d3roub1:

• d3roub1 first appeared in SCOPe 2.03
  
• d3roub1 appears in SCOPe 2.05
  
• d3roub1 appears in the current release, SCOPe 2.08