Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
Domain d1fytb1: 1fyt B:93-190 [21596] Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb2, d1fytd1, d1fytd2, d1fyte1, d1fyte2 complexed with nag |
PDB Entry: 1fyt (more details), 2.6 Å
SCOPe Domain Sequences for d1fytb1:
Sequence, based on SEQRES records: (download)
>d1fytb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewra
>d1fytb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsllvcsvsgfypgsievrwfrngqeekagvvstgliqngdwtfqtlvml etvprsgevytcqvehpsvtspltvewra
Timeline for d1fytb1: