SCOPe 2.03: Domain d3roeb_: 3roe B:

Lineage for d3roeb_ (3roe B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest

4. Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families)
   possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain)

5. Family c.104.1.0: automated matches [227138] (1 protein)
   not a true family

6. Protein automated matches [226840] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224913] (8 PDB entries)

8. Domain d3roeb_: 3roe B: [215956]
   automated match to d1jzta_
   complexed with thm

Details for d3roeb_

PDB Entry: 3roe, 2.11 Å

PDB Description: crystal structure of mouse apolipoprotein a-i binding protein in complex with thymidine

PDB Compounds: (B:) Apolipoprotein A-I-binding protein

SCOPe Domain Sequences for d3roeb_:

Sequence; same for both SEQRES and ATOM records:

>d3roeb_ c.104.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avkylsqeeaqavdqelfneyqfsvdqlmelaglscataiakaypptsmskspptvlvic
gpgnnggdglvcarhlklfgyqptiyypkrpnkplftglvtqcqkmdipflgemppepmm
vdelyelvvdaifgfsfkgdvrepfhsilsvlsgltvpiasidipsgwdvekgnpsgiqp
dllisltapkksathftgryhylggrfvppalekkyqlnlpsypdtecvyrlq

Timeline for d3roeb_:

• d3roeb_ is new in SCOPe 2.03-stable
  
• d3roeb_ appears in SCOPe 2.04
  
• d3roeb_ appears in the current release, SCOPe 2.08