| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
| Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
| Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species) |
| Species Candida glabrata [TaxId:284593] [237803] (4 PDB entries) |
| Domain d3roab1: 3roa B:3-217 [215950] Other proteins in same PDB: d3roaa2, d3roab2 automated match to d3ro9b_ complexed with 06v, cl, ndp |
PDB Entry: 3roa (more details), 2.3 Å
SCOPe Domain Sequences for d3roab1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3roab1 c.71.1.1 (B:3-217) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 284593]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkk
Timeline for d3roab1: