SCOPe 2.07: Domain d3roab1: 3roa B:3-217

Lineage for d3roab1 (3roa B:3-217)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Candida glabrata [TaxId:284593] [237803] (4 PDB entries)

8. Domain d3roab1: 3roa B:3-217 [215950]
   Other proteins in same PDB: d3roaa2, d3roab2
   automated match to d3ro9b_
   complexed with 06v, cl, ndp

Details for d3roab1

PDB Entry: 3roa, 2.3 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with nadph and 6- ethyl-5-[(3r)-3-[3-methoxy-5-(morpholin-4-yl)phenyl]but-1-yn-1- yl]pyrimidine-2,4-diamine (ucp1004)

PDB Compounds: (B:) Strain CBS138 chromosome J complete sequence

SCOPe Domain Sequences for d3roab1:

Sequence; same for both SEQRES and ATOM records:

>d3roab1 c.71.1.1 (B:3-217) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 284593]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkk

Timeline for d3roab1:

• d3roab1 first appeared in SCOPe 2.03, called d3roab_
  
• d3roab1 appears in SCOPe 2.06
  
• d3roab1 appears in the current release, SCOPe 2.08