Lineage for d3roab1 (3roa B:3-217)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2153715Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2153716Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2153717Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2153920Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 2153921Species Candida glabrata [TaxId:284593] [237803] (4 PDB entries)
  8. 2153925Domain d3roab1: 3roa B:3-217 [215950]
    Other proteins in same PDB: d3roaa2, d3roab2
    automated match to d3ro9b_
    complexed with 06v, cl, ndp

Details for d3roab1

PDB Entry: 3roa (more details), 2.3 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with nadph and 6- ethyl-5-[(3r)-3-[3-methoxy-5-(morpholin-4-yl)phenyl]but-1-yn-1- yl]pyrimidine-2,4-diamine (ucp1004)
PDB Compounds: (B:) Strain CBS138 chromosome J complete sequence

SCOPe Domain Sequences for d3roab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3roab1 c.71.1.1 (B:3-217) Dihydrofolate reductases, eukaryotic type {Candida glabrata [TaxId: 284593]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkk

SCOPe Domain Coordinates for d3roab1:

Click to download the PDB-style file with coordinates for d3roab1.
(The format of our PDB-style files is described here.)

Timeline for d3roab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3roab2