SCOPe 2.03: Domain d3roab_: 3roa B:

Lineage for d3roab_ (3roa B:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein automated matches [190514] (8 species)
   not a true protein

7. Species Candida glabrata [TaxId:5478] [193188] (2 PDB entries)

8. Domain d3roab_: 3roa B: [215950]
   automated match to d3ro9b_
   complexed with 06v, cl, nap

Details for d3roab_

PDB Entry: 3roa, 2.3 Å

PDB Description: candida glabrata dihydrofolate reductase complexed with nadph and 6- ethyl-5-[(3r)-3-[3-methoxy-5-(morpholin-4-yl)phenyl]but-1-yn-1- yl]pyrimidine-2,4-diamine (ucp1004)

PDB Compounds: (B:) Strain CBS138 chromosome J complete sequence

SCOPe Domain Sequences for d3roab_:

Sequence; same for both SEQRES and ATOM records:

>d3roab_ c.71.1.1 (B:) automated matches {Candida glabrata [TaxId: 5478]}
kvpvvgivaallpemgigfqgnlpwrlakemkyfrevttltndnskqnvvimgrktwesi
pqkfrplpkrinvvvsrsfdgelrkvedgiyhsnslrncltalqsslanenkieriyiig
ggeiyrqsmdladhwlitkimplpettipqmdtflqkqeleqrfydnsdklvdflpssiq
legrltsqewngelvkglpvqekgyqfyftlytkklehhhhhhhh

Timeline for d3roab_:

• d3roab_ is new in SCOPe 2.03-stable
  
• d3roab_ appears in SCOPe 2.04
  
• d3roab_ appears in the current release, SCOPe 2.08, called d3roab1