Lineage for d1fyta1 (1fyt A:82-181)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103536Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (11 species)
  7. 103543Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (6 PDB entries)
  8. 103560Domain d1fyta1: 1fyt A:82-181 [21595]
    Other proteins in same PDB: d1fyta2, d1fytb2, d1fytd1, d1fytd2, d1fyte1, d1fyte2

Details for d1fyta1

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fyta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fyta1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

SCOP Domain Coordinates for d1fyta1:

Click to download the PDB-style file with coordinates for d1fyta1.
(The format of our PDB-style files is described here.)

Timeline for d1fyta1: