SCOP 1.55: Domain d1fyta1: 1fyt A:82-181

Lineage for d1fyta1 (1fyt A:82-181)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (9 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (5 PDB entries)

8. Domain d1fyta1: 1fyt A:82-181 [21595]
   Other proteins in same PDB: d1fyta2, d1fytb2, d1fytd1, d1fytd2, d1fyte1, d1fyte2

Details for d1fyta1

PDB Entry: 1fyt, 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fyta1:

Sequence; same for both SEQRES and ATOM records:

>d1fyta1 b.1.1.2 (A:82-181) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwefd

Timeline for d1fyta1:

• d1fyta1 appears in SCOP 1.57
  
• d1fyta1 appears in the current release, SCOPe 2.08