Lineage for d3ro8b_ (3ro8 B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820602Species Paenibacillus sp. [TaxId:324057] [193799] (3 PDB entries)
  8. 1820606Domain d3ro8b_: 3ro8 B: [215942]
    automated match to d3rdkb_
    complexed with cl, mg

Details for d3ro8b_

PDB Entry: 3ro8 (more details), 1.34 Å

PDB Description: Crystal structure of the catalytic domain of XynA1 from Paenibacillus sp. JDR-2
PDB Compounds: (B:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3ro8b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ro8b_ c.1.8.0 (B:) automated matches {Paenibacillus sp. [TaxId: 324057]}
shmaplkdvykndflignaisaedlegtrlellkmhhdvvtagnamkpdalqptkgnftf
taadamidkvlaegmkmhghvlvwhqqspawlntkkddnnntvplgrdealdnlrthiqt
vmkhfgnkviswdvvneamndnpsnpadykaslrqtpwyqaigsdyveqaflaarevlde
npswniklyyndynednqnkataiynmvkdindryaaahngkllidgvgmqghynintnp
dnvklslekfislgvevsvseldvtagnnytlpenlavgqaylyaqlfklykehadhiar
vtfw

SCOPe Domain Coordinates for d3ro8b_:

Click to download the PDB-style file with coordinates for d3ro8b_.
(The format of our PDB-style files is described here.)

Timeline for d3ro8b_: