Lineage for d3ro7a_ (3ro7 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490567Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest
  4. 2490568Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families) (S)
    possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain)
  5. 2490597Family c.104.1.0: automated matches [227138] (1 protein)
    not a true family
  6. 2490598Protein automated matches [226840] (1 species)
    not a true protein
  7. 2490599Species Mouse (Mus musculus) [TaxId:10090] [224913] (8 PDB entries)
  8. 2490610Domain d3ro7a_: 3ro7 A: [215940]
    automated match to d1jzta_
    complexed with so4, tdr

Details for d3ro7a_

PDB Entry: 3ro7 (more details), 2.5 Å

PDB Description: Crystal Structure of Mouse Apolipoprotein A-I Binding Protein in Complex with Thymine.
PDB Compounds: (A:) Apolipoprotein A-I-binding protein

SCOPe Domain Sequences for d3ro7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ro7a_ c.104.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avkylsqeeaqavdqelfneyqfsvdqlmelaglscataiakaypptsmskspptvlvic
gpgnnggdglvcarhlklfgyqptiyypkrpnkplftglvtqcqkmdipflgemppepmm
vdelyelvvdaifgfsfkgdvrepfhsilsvlsgltvpiasidipsgwdvekgnpsgiqp
dllisltapkksathftgryhylggrfvppalekkyqlnlpsypdtecvyrlq

SCOPe Domain Coordinates for d3ro7a_:

Click to download the PDB-style file with coordinates for d3ro7a_.
(The format of our PDB-style files is described here.)

Timeline for d3ro7a_: