Lineage for d2sebb1 (2seb B:93-190)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364889Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)
  7. 364897Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (25 PDB entries)
    probably orthologous to the mouse I-E group
  8. 364915Domain d2sebb1: 2seb B:93-190 [21594]
    Other proteins in same PDB: d2seba1, d2seba2, d2sebb2, d2sebd1, d2sebd2
    complexed with nag

Details for d2sebb1

PDB Entry: 2seb (more details), 2.5 Å

PDB Description: x-ray crystal structure of hla-dr4 complexed with a peptide from human collagen ii

SCOP Domain Sequences for d2sebb1:

Sequence, based on SEQRES records: (download)

>d2sebb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvypevtvypaktqplqhhnllvcsvngfypgsievrwfrngqeektgvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsltspltvewra

Sequence, based on observed residues (ATOM records): (download)

>d2sebb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
rrvypevtvypanllvcsvngfypgsievrwfrngqeektgvvstgliqngdwtfqtlvm
letvevytcqvehpsltspltvewra

SCOP Domain Coordinates for d2sebb1:

Click to download the PDB-style file with coordinates for d2sebb1.
(The format of our PDB-style files is described here.)

Timeline for d2sebb1: