Lineage for d3ro6b2 (3ro6 B:126-354)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1343755Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1344084Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1344085Protein automated matches [226923] (45 species)
    not a true protein
  7. 1344229Species Methylococcus capsulatus [TaxId:414] [226117] (2 PDB entries)
  8. 1344231Domain d3ro6b2: 3ro6 B:126-354 [215931]
    Other proteins in same PDB: d3ro6a1, d3ro6b1, d3ro6c1, d3ro6d1, d3ro6e1, d3ro6f1
    automated match to d1jpma1
    complexed with gol, mg, so4

Details for d3ro6b2

PDB Entry: 3ro6 (more details), 2.2 Å

PDB Description: crystal structure of dipeptide epimerase from methylococcus capsulatus complexed with mg ion
PDB Compounds: (B:) Putative chloromuconate cycloisomerase

SCOPe Domain Sequences for d3ro6b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ro6b2 c.1.11.0 (B:126-354) automated matches {Methylococcus capsulatus [TaxId: 414]}
ahdslptsvtigikpveetlaearehlalgfrvlkvklcgdeeqdferlrrlhetlagra
vvrvdpnqsydrdgllrldrlvqelgiefieqpfpagrtdwlralpkairrriaadesll
gpadafalaappaacgifniklmkcgglaparriatiaetagidlmwgcmdesrisiaaa
lhaalacpatryldldgsfdlardvaeggfiledgrlrvterpglglvy

SCOPe Domain Coordinates for d3ro6b2:

Click to download the PDB-style file with coordinates for d3ro6b2.
(The format of our PDB-style files is described here.)

Timeline for d3ro6b2: