Lineage for d3rnoa_ (3rno A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882948Fold c.104: YjeF N-terminal domain-like [64152] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 32145678; strand 8 is antiparallel to the rest
  4. 1882949Superfamily c.104.1: YjeF N-terminal domain-like [64153] (2 families) (S)
    possible circular permutation of the ribokinase-like fold (of the YjeF C-terminal domain)
  5. 1882978Family c.104.1.0: automated matches [227138] (1 protein)
    not a true family
  6. 1882979Protein automated matches [226840] (1 species)
    not a true protein
  7. 1882980Species Mouse (Mus musculus) [TaxId:10090] [224913] (8 PDB entries)
  8. 1882990Domain d3rnoa_: 3rno A: [215926]
    automated match to d1jzta_
    complexed with nap

Details for d3rnoa_

PDB Entry: 3rno (more details), 2.5 Å

PDB Description: crystal structure of mouse apolipoprotein a-i binding protein in complex with nadp.
PDB Compounds: (A:) Apolipoprotein A-I-binding protein

SCOPe Domain Sequences for d3rnoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rnoa_ c.104.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avkylsqeeaqavdqelfneyqfsvdqlmelaglscataiakaypptsmskspptvlvic
gpgnnggdglvcarhlklfgyqptiyypkrpnkplftglvtqcqkmdipflgemppepmm
vdelyelvvdaifgfsfkgdvrepfhsilsvlsgltvpiasidipsgwdvekgnpsgiqp
dllisltapkksathftgryhylggrfvppalekkyqlnlpsypdtecvyrlq

SCOPe Domain Coordinates for d3rnoa_:

Click to download the PDB-style file with coordinates for d3rnoa_.
(The format of our PDB-style files is described here.)

Timeline for d3rnoa_: