SCOPe 2.05: Domain d3rn4a2: 3rn4 A:103-213

Lineage for d3rn4a2 (3rn4 A:103-213)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (30 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226252] (2 PDB entries)

8. Domain d3rn4a2: 3rn4 A:103-213 [215924]
   Other proteins in same PDB: d3rn4a1
   automated match to d1p7ga2
   complexed with fe

Details for d3rn4a2

PDB Entry: 3rn4, 1.79 Å

PDB Description: Crystal structure of iron-substituted Sod2 from Saccharomyces cerevisiae

PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d3rn4a2:

Sequence; same for both SEQRES and ATOM records:

>d3rn4a2 d.44.1.0 (A:103-213) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvqtynq
dtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdag

Timeline for d3rn4a2:

• d3rn4a2 first appeared in SCOPe 2.03
  
• d3rn4a2 appears in SCOPe 2.04
  
• d3rn4a2 appears in SCOPe 2.06
  
• d3rn4a2 appears in the current release, SCOPe 2.08