| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
| Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
| Protein automated matches [226860] (30 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226252] (2 PDB entries) |
| Domain d3rn4a2: 3rn4 A:103-213 [215924] Other proteins in same PDB: d3rn4a1 automated match to d1p7ga2 complexed with fe |
PDB Entry: 3rn4 (more details), 1.79 Å
SCOPe Domain Sequences for d3rn4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rn4a2 d.44.1.0 (A:103-213) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvqtynq
dtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdag
Timeline for d3rn4a2: