| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
| Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
| Protein automated matches [226859] (39 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226251] (2 PDB entries) |
| Domain d3rn4a1: 3rn4 A:9-102 [215923] Other proteins in same PDB: d3rn4a2 automated match to d1p7ga1 complexed with fe |
PDB Entry: 3rn4 (more details), 1.79 Å
SCOPe Domain Sequences for d3rn4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rn4a1 a.2.11.0 (A:9-102) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
kvtlpdlkwdfgalepyisgqinelhytkhhqtyvngfntavdqfqelsdllakepspan
arkmiaiqqnikfhgggftnhclfwenlapesqg
Timeline for d3rn4a1: