Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Class II MHC beta chain, C-terminal domain [88625] (6 species) |
Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88628] (41 PDB entries) Uniprot P04229 30-219 probably orthologous to the mouse I-E group |
Domain d1aqdk1: 1aqd K:93-191 [21592] Other proteins in same PDB: d1aqda1, d1aqda2, d1aqdb2, d1aqdd1, d1aqdd2, d1aqde2, d1aqdg1, d1aqdg2, d1aqdh2, d1aqdj1, d1aqdj2, d1aqdk2 |
PDB Entry: 1aqd (more details), 2.45 Å
SCOPe Domain Sequences for d1aqdk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1aqdk1 b.1.1.2 (K:93-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd wtfqtlvmletvprsgevytcqvehpsvtspltvewrar
Timeline for d1aqdk1: