SCOP 1.63: Domain d1aqdk1: 1aqd K:93-191

Lineage for d1aqdk1 (1aqd K:93-191)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class II MHC, C-terminal domains of alpha and beta chains [49132] (12 species)

7. Species Human (Homo sapiens), HLA-DR1 [TaxId:9606] [49134] (11 PDB entries)

8. Domain d1aqdk1: 1aqd K:93-191 [21592]
   Other proteins in same PDB: d1aqda2, d1aqdb2, d1aqdd2, d1aqde2, d1aqdg2, d1aqdh2, d1aqdj2, d1aqdk2

Details for d1aqdk1

PDB Entry: 1aqd, 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

SCOP Domain Sequences for d1aqdk1:

Sequence; same for both SEQRES and ATOM records:

>d1aqdk1 b.1.1.2 (K:93-191) Class II MHC, C-terminal domains of alpha and beta chains {Human (Homo sapiens), HLA-DR1}
rrvepkvtvypsktqplqhhnllvcsvsgfypgsievrwfrngqeekagvvstgliqngd
wtfqtlvmletvprsgevytcqvehpsvtspltvewrar

Timeline for d1aqdk1:

• d1aqdk1 first appeared (with stable ids) in SCOP 1.55
  
• d1aqdk1 appears in SCOP 1.61
  
• d1aqdk1 appears in SCOP 1.65
  
• d1aqdk1 appears in the current release, SCOPe 2.08