SCOPe 2.05: Domain d3rkub_: 3rku B:

Lineage for d3rkub_ (3rku B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225295] (2 PDB entries)

8. Domain d3rkub_: 3rku B: [215911]
   automated match to d3tsca_
   complexed with nap

Details for d3rkub_

PDB Entry: 3rku, 2.6 Å

PDB Description: Substrate Fingerprint and the Structure of NADP+ Dependent Serine Dehydrogenase from Saccharomyces cerevisiae complexed with NADP+

PDB Compounds: (B:) Oxidoreductase YMR226C

SCOPe Domain Sequences for d3rkub_:

Sequence; same for both SEQRES and ATOM records:

>d3rkub_ c.2.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
hmsqgrkaaerlakktvlitgasagigkataleyleasngdmklilaarrlekleelkkt
idqefpnakvhvaqlditqaekikpfienlpqefkdidilvnnagkalgsdrvgqiated
iqdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrdayptgsiycaskfavgaft
dslrkelintkirviliapglvetefslvryrgneeqaknvykdttplmaddvadlivya
tsrkqntviadtlifptnqasphhifrg

Timeline for d3rkub_:

• d3rkub_ first appeared in SCOPe 2.03
  
• d3rkub_ appears in SCOPe 2.04
  
• d3rkub_ is called d3rkub1 in SCOPe 2.06
  
• d3rkub_ appears in the current release, SCOPe 2.08, called d3rkub1