| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (319 species) not a true protein |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225295] (5 PDB entries) |
| Domain d3rkub1: 3rku B:1-267 [215911] Other proteins in same PDB: d3rkua2, d3rkub2, d3rkuc2, d3rkud2 automated match to d3tsca_ complexed with nap |
PDB Entry: 3rku (more details), 2.6 Å
SCOPe Domain Sequences for d3rkub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rkub1 c.2.1.0 (B:1-267) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msqgrkaaerlakktvlitgasagigkataleyleasngdmklilaarrlekleelkkti
dqefpnakvhvaqlditqaekikpfienlpqefkdidilvnnagkalgsdrvgqiatedi
qdvfdtnvtalinitqavlpifqaknsgdivnlgsiagrdayptgsiycaskfavgaftd
slrkelintkirviliapglvetefslvryrgneeqaknvykdttplmaddvadlivyat
srkqntviadtlifptnqasphhifrg
Timeline for d3rkub1: