Lineage for d3rkra_ (3rkr A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2096397Species Uncultured bacterium [TaxId:460938] [226261] (1 PDB entry)
  8. 2096398Domain d3rkra_: 3rkr A: [215906]
    automated match to d3tzha_
    complexed with nap, so4

Details for d3rkra_

PDB Entry: 3rkr (more details), 2.42 Å

PDB Description: Crystal structure of a metagenomic short-chain oxidoreductase (SDR) in complex with NADP
PDB Compounds: (A:) Short chain oxidoreductase

SCOPe Domain Sequences for d3rkra_:

Sequence, based on SEQRES records: (download)

>d3rkra_ c.2.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 460938]}
sslsgqvavvtgasrgigaaiarklgslgarvvltardveklravereivaaggeaesha
cdlshsdaiaafatgvlaahgrcdvlvnnagvgwfggplhtmkpaewdaliavnlkapyl
llrafapamiaakrghiinisslagknpvadgaaytaskwglnglmtsaaeelrqhqvrv
slvapgsvrtefgvglsakksalgaiepddiadvvallatqadqsfisevlvrptlk

Sequence, based on observed residues (ATOM records): (download)

>d3rkra_ c.2.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 460938]}
sslsgqvavvtgasrgigaaiarklgslgarvvltardveklravereivaaggeaesha
cdlshsdaiaafatgvlaahgrcdvlvnnagvgwfggplhtmkpaewdaliavnlkapyl
llrafapamiaakrghiinisslagknpvadgaaytaskwglnglmtsaaeelrqhqvrv
slvapgsvaiepddiadvvallatqadqsfisevlvrptlk

SCOPe Domain Coordinates for d3rkra_:

Click to download the PDB-style file with coordinates for d3rkra_.
(The format of our PDB-style files is described here.)

Timeline for d3rkra_: