Lineage for d3rjlb_ (3rjl B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140671Fold c.82: ALDH-like [53719] (1 superfamily)
    consists of two similar domains with 3 layers (a/b/a) each; duplication
    core: parallel beta-sheet of 5 strands, order 32145
  4. 2140672Superfamily c.82.1: ALDH-like [53720] (3 families) (S)
    binds NAD differently from other NAD(P)-dependent oxidoreductases
  5. 2141090Family c.82.1.0: automated matches [191448] (1 protein)
    not a true family
  6. 2141091Protein automated matches [190683] (49 species)
    not a true protein
  7. 2141145Species Bacillus licheniformis [TaxId:279010] [226118] (1 PDB entry)
  8. 2141147Domain d3rjlb_: 3rjl B: [215890]
    automated match to d2bjka_
    complexed with act, cd

Details for d3rjlb_

PDB Entry: 3rjl (more details), 2.2 Å

PDB Description: Crystal structure of 1-pyrroline-5-carboxylate dehydrogenase from Bacillus licheniformis (Target NYSGRC-000337)
PDB Compounds: (B:) 1-pyrroline-5-carboxylate dehydrogenase

SCOPe Domain Sequences for d3rjlb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rjlb_ c.82.1.0 (B:) automated matches {Bacillus licheniformis [TaxId: 279010]}
tpykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpanke
evvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsallvk
eagkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvippw
nflfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsgaev
gdylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedcdi
elaaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvymgp
vidqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifgpv
vafskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaivgy
hpfggfkmsgtdskaggpdylalhmqaktisemf

SCOPe Domain Coordinates for d3rjlb_:

Click to download the PDB-style file with coordinates for d3rjlb_.
(The format of our PDB-style files is described here.)

Timeline for d3rjlb_: