Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (59 species) not a true protein |
Species Bacillus licheniformis [TaxId:279010] [226118] (1 PDB entry) |
Domain d3rjla_: 3rjl A: [215889] automated match to d2bjka_ complexed with act, cd |
PDB Entry: 3rjl (more details), 2.2 Å
SCOPe Domain Sequences for d3rjla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rjla_ c.82.1.0 (A:) automated matches {Bacillus licheniformis [TaxId: 279010]} pykhepftnfgieenrkafekaletvnnewlgqsyplvidgeryetenkivsinpankee vvgtvskatqdhaekaiqaaakafetwrytdpeeraavlfravakvrrkkhefsallvke agkpwneadadtaeaidfmeyyarqmielakgkpvnsregernqyvytptgvtvvippwn flfaimagttvapivtgntvvlkpasaapviaakfvevleesglpkgvvnfvpgsgaevg dylvdhpktsiitftgsrevgtriferaakvqpgqthlkqviaemggkdtvvvdedcdie laaqsiftsafgfagqkcsagsravvhekvydevlkrvieiteskkvgepdsadvymgpv idqasfnkimdyieigkeegrlvsggkgddskgyfieptifadldpkarlmqeeifgpvv afskvssfdealevannteygltgavitknrdhinrakqefhvgnlyfnrnctgaivgyh pfggfkmsgtdskaggpdylalhmqaktisemf
Timeline for d3rjla_: