SCOPe 2.07: Domain d3rjja2: 3rjj A:92-148

Lineage for d3rjja2 (3rjj A:92-148)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)

8. Domain d3rjja2: 3rjj A:92-148 [215884]
   Other proteins in same PDB: d3rjja1, d3rjja3
   automated match to d1tv9a2
   protein/DNA complex; complexed with na

Details for d3rjja2

PDB Entry: 3rjj, 2 Å

PDB Description: Ternary complex crystal structure of DNA Polymerase Beta with template 8odG provides insight into mutagenic lesion bypass

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3rjja2:

Sequence; same for both SEQRES and ATOM records:

>d3rjja2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

Timeline for d3rjja2:

• d3rjja2 first appeared in SCOPe 2.03
  
• d3rjja2 appears in SCOPe 2.06
  
• d3rjja2 appears in the current release, SCOPe 2.08