SCOPe 2.07: Domain d3rjia2: 3rji A:92-148

Lineage for d3rjia2 (3rji A:92-148)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)

8. Domain d3rjia2: 3rji A:92-148 [215881]
   Other proteins in same PDB: d3rjia1, d3rjia3
   automated match to d1tv9a2
   protein/DNA complex; complexed with 6cf, cl, mg, na

Details for d3rjia2

PDB Entry: 3rji, 2.3 Å

PDB Description: Ternary complex of DNA Polymerase Beta with a gapped DNA containing 8odG at template position paired with non-hydrolyzable dCTP analog (dCMP(CF2)PP)

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3rjia2:

Sequence; same for both SEQRES and ATOM records:

>d3rjia2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

Timeline for d3rjia2:

• d3rjia2 first appeared in SCOPe 2.03
  
• d3rjia2 appears in SCOPe 2.06
  
• d3rjia2 appears in the current release, SCOPe 2.08