Lineage for d3rjga2 (3rjg A:92-148)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2325087Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2325088Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 2325089Protein DNA polymerase beta [81579] (2 species)
  7. 2325090Species Human (Homo sapiens) [TaxId:9606] [81575] (145 PDB entries)
  8. 2325101Domain d3rjga2: 3rjg A:92-148 [215875]
    Other proteins in same PDB: d3rjga1, d3rjga3
    automated match to d1tv9a2
    protein/DNA complex; complexed with na

Details for d3rjga2

PDB Entry: 3rjg (more details), 2 Å

PDB Description: Binary complex of DNA Polymerase Beta with a gapped DNA containing 8odG:dA base-pair at primer Terminus
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d3rjga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rjga2 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d3rjga2:

Click to download the PDB-style file with coordinates for d3rjga2.
(The format of our PDB-style files is described here.)

Timeline for d3rjga2: