Lineage for d1aqdd1 (1aqd D:82-179)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 784786Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)
  7. 784794Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
    Uniprot P01903 28-207
    probably orthologous to the mouse I-E group
  8. 784810Domain d1aqdd1: 1aqd D:82-179 [21587]
    Other proteins in same PDB: d1aqda2, d1aqdb1, d1aqdb2, d1aqdd2, d1aqde1, d1aqde2, d1aqdg2, d1aqdh1, d1aqdh2, d1aqdj2, d1aqdk1, d1aqdk2

Details for d1aqdd1

PDB Entry: 1aqd (more details), 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide
PDB Compounds: (D:) hla-dr1 class II histocompatibility protein

SCOP Domain Sequences for d1aqdd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aqdd1 b.1.1.2 (D:82-179) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwe

SCOP Domain Coordinates for d1aqdd1:

Click to download the PDB-style file with coordinates for d1aqdd1.
(The format of our PDB-style files is described here.)

Timeline for d1aqdd1: