SCOP 1.69: Domain d1aqdd1: 1aqd D:82-179

Lineage for d1aqdd1 (1aqd D:82-179)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Human (Homo sapiens), HLA-DR group [TaxId:9606] [88621] (29 PDB entries)
   probably orthologous to the mouse I-E group

8. Domain d1aqdd1: 1aqd D:82-179 [21587]
   Other proteins in same PDB: d1aqda2, d1aqdb1, d1aqdb2, d1aqdd2, d1aqde1, d1aqde2, d1aqdg2, d1aqdh1, d1aqdh2, d1aqdj2, d1aqdk1, d1aqdk2

Details for d1aqdd1

PDB Entry: 1aqd, 2.45 Å

PDB Description: hla-dr1 (dra, drb1 0101) human class ii histocompatibility protein (extracellular domain) complexed with endogenous peptide

SCOP Domain Sequences for d1aqdd1:

Sequence; same for both SEQRES and ATOM records:

>d1aqdd1 b.1.1.2 (D:82-179) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DR group}
itnvppevtvltnspvelrepnvlicfidkftppvvnvtwlrngkpvttgvsetvflpre
dhlfrkfhylpflpstedvydcrvehwgldepllkhwe

Timeline for d1aqdd1:

• d1aqdd1 first appeared (with stable ids) in SCOP 1.55
  
• d1aqdd1 appears in SCOP 1.67
  
• d1aqdd1 appears in SCOP 1.71
  
• d1aqdd1 appears in the current release, SCOPe 2.08