![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Methylococcus capsulatus [TaxId:414] [226116] (2 PDB entries) |
![]() | Domain d3ritd1: 3rit D:1-125 [215861] Other proteins in same PDB: d3rita2, d3ritb2, d3ritc2, d3ritd2, d3rite2 automated match to d1jpma2 complexed with 1pe, arg, dly, mg, so4 |
PDB Entry: 3rit (more details), 2.7 Å
SCOPe Domain Sequences for d3ritd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ritd1 d.54.1.0 (D:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]} mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv eilgr
Timeline for d3ritd1: