SCOPe 2.08: Domain d3ritb1: 3rit B:1-125

Lineage for d3ritb1 (3rit B:1-125)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Methylococcus capsulatus [TaxId:414] [226116] (2 PDB entries)

8. Domain d3ritb1: 3rit B:1-125 [215857]
   Other proteins in same PDB: d3rita2, d3ritb2, d3ritc2, d3ritd2, d3rite2
   automated match to d1jpma2
   complexed with 1pe, arg, dly, mg, so4

Details for d3ritb1

PDB Entry: 3rit, 2.7 Å

PDB Description: Crystal structure of Dipeptide Epimerase from Methylococcus capsulatus complexed with Mg and dipeptide L-Arg-D-Lys

PDB Compounds: (B:) Dipeptide Epimerase

SCOPe Domain Sequences for d3ritb1:

Sequence; same for both SEQRES and ATOM records:

>d3ritb1 d.54.1.0 (B:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]}
mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
eilgr

Timeline for d3ritb1:

• d3ritb1 first appeared in SCOPe 2.03
  
• d3ritb1 appears in SCOPe 2.07