Lineage for d3ritb1 (3rit B:1-125)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948333Species Methylococcus capsulatus [TaxId:414] [226116] (2 PDB entries)
  8. 2948335Domain d3ritb1: 3rit B:1-125 [215857]
    Other proteins in same PDB: d3rita2, d3ritb2, d3ritc2, d3ritd2, d3rite2
    automated match to d1jpma2
    complexed with 1pe, arg, dly, mg, so4

Details for d3ritb1

PDB Entry: 3rit (more details), 2.7 Å

PDB Description: Crystal structure of Dipeptide Epimerase from Methylococcus capsulatus complexed with Mg and dipeptide L-Arg-D-Lys
PDB Compounds: (B:) Dipeptide Epimerase

SCOPe Domain Sequences for d3ritb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ritb1 d.54.1.0 (B:1-125) automated matches {Methylococcus capsulatus [TaxId: 414]}
mkiadiqvrtehfpltrpyriafrsieeidnliveirtadgllglgaasperhvtgetle
achaaldhdrlgwlmgrdirtlprlcrelaerlpaapaaraaldmalhdlvaqclglplv
eilgr

SCOPe Domain Coordinates for d3ritb1:

Click to download the PDB-style file with coordinates for d3ritb1.
(The format of our PDB-style files is described here.)

Timeline for d3ritb1: