SCOP 1.73: Domain d1hdmb1: 1hdm B:88-185

Lineage for d1hdmb1 (1hdm B:88-185)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC beta chain, C-terminal domain [88625] (6 species)

7. Species Human (Homo sapiens), HLA-DM [TaxId:9606] [88626] (1 PDB entry)
   probably orthologous to the mouse H2-DM

8. Domain d1hdmb1: 1hdm B:88-185 [21584]
   Other proteins in same PDB: d1hdma1, d1hdma2, d1hdmb2

Details for d1hdmb1

PDB Entry: 1hdm, 2.5 Å

PDB Description: histocompatibility antigen hla-dm

PDB Compounds: (B:) protein (class II histocompatibility antigen, m beta chain)

SCOP Domain Sequences for d1hdmb1:

Sequence; same for both SEQRES and ATOM records:

>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]}
trppsvqvakttpfntrepvmlacyvwgfypaevtitwrkngklvmhssahktaqpngdw
tyqtlshlaltpsygdtytcvvehigapepilrdwtpg

Timeline for d1hdmb1:

• d1hdmb1 first appeared (with stable ids) in SCOP 1.55
  
• d1hdmb1 appears in SCOP 1.71
  
• d1hdmb1 appears in SCOP 1.75
  
• d1hdmb1 appears in the current release, SCOPe 2.08