SCOPe 2.05: Domain d3rica_: 3ric A:

Lineage for d3rica_ (3ric A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
   multihelical; 2 layers or orthogonally packed helices

4. Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family)

5. Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)

6. Protein Glycolipid transfer protein, GLTP [110006] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
   Uniprot Q9NZD2

8. Domain d3rica_: 3ric A: [215829]
   automated match to d4ghpa_
   complexed with cis; mutant

Details for d3rica_

PDB Entry: 3ric, 2.1 Å

PDB Description: crystal structure of d48v||a47d mutant of human glycolipid transfer protein complexed with 3-o-sulfo-galactosylceramide containing nervonoyl acyl chain (24:1)

PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d3rica_:

Sequence; same for both SEQRES and ATOM records:

>d3rica_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
llaehllkplpadkqietgpfleavshlppffdclgspvftpikdvisgnitkikavydt
npakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpn
lirvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirl
flvnytatidviyemytqmnaelnykv

Timeline for d3rica_:

• d3rica_ first appeared in SCOPe 2.03
  
• d3rica_ appears in SCOPe 2.04
  
• d3rica_ appears in SCOPe 2.06
  
• d3rica_ appears in the current release, SCOPe 2.08