Lineage for d3rhka_ (3rhk A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2218047Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2218048Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2218179Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2219750Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
    PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2219751Species Human (Homo sapiens) [TaxId:9606] [103301] (52 PDB entries)
  8. 2219763Domain d3rhka_: 3rhk A: [215826]
    automated match to d3dkga_
    complexed with m97

Details for d3rhka_

PDB Entry: 3rhk (more details), 1.94 Å

PDB Description: Crystal structure of the catalytic domain of c-Met kinase in complex with ARQ 197
PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d3rhka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rhka_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
ntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihca
vkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnf
irnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglard
mydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvn
tfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig

SCOPe Domain Coordinates for d3rhka_:

Click to download the PDB-style file with coordinates for d3rhka_.
(The format of our PDB-style files is described here.)

Timeline for d3rhka_: