Lineage for d3rhba_ (3rhb A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2488285Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [196344] (34 PDB entries)
  8. 2488287Domain d3rhba_: 3rhb A: [215825]
    automated match to d3rhcb_
    complexed with gsh, so4

Details for d3rhba_

PDB Entry: 3rhb (more details), 1.2 Å

PDB Description: crystal structure of the apo form of glutaredoxin c5 from arabidopsis thaliana
PDB Compounds: (A:) Glutaredoxin-C5, chloroplastic

SCOPe Domain Sequences for d3rhba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rhba_ c.47.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
srmeesirktvtentvviysktwcsyctevktlfkrlgvqplvveldqlgpqgpqlqkvl
erltgqhtvpnvfvcgkhiggctdtvklnrkgdlelmlae

SCOPe Domain Coordinates for d3rhba_:

Click to download the PDB-style file with coordinates for d3rhba_.
(The format of our PDB-style files is described here.)

Timeline for d3rhba_: