Lineage for d3rh0b_ (3rh0 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874901Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2874902Protein automated matches [190574] (20 species)
    not a true protein
  7. 2874914Species Corynebacterium glutamicum [TaxId:1718] [226260] (1 PDB entry)
  8. 2874916Domain d3rh0b_: 3rh0 B: [215821]
    automated match to d1jl3a_

Details for d3rh0b_

PDB Entry: 3rh0 (more details), 1.72 Å

PDB Description: Corynebacterium glutamicum mycothiol/mycoredoxin1-dependent arsenate reductase Cg_ArsC2
PDB Compounds: (B:) arsenate reductase

SCOPe Domain Sequences for d3rh0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rh0b_ c.44.1.0 (B:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
mksvlfvcvgnggksqmaaalaqkyasdsveihsagtkpaqglnqlsvesiaevgadmsq
gipkaidpellrtvdrvvilgddaqvdmpesaqgalerwsieepdaqgmermrivrdqid
nrvqallag

SCOPe Domain Coordinates for d3rh0b_:

Click to download the PDB-style file with coordinates for d3rh0b_.
(The format of our PDB-style files is described here.)

Timeline for d3rh0b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3rh0a_