SCOPe 2.08: Domain d3rh0b_: 3rh0 B:

Lineage for d3rh0b_ (3rh0 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.0: automated matches [191415] (1 protein)
   not a true family

6. Protein automated matches [190574] (20 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [226260] (1 PDB entry)

8. Domain d3rh0b_: 3rh0 B: [215821]
   automated match to d1jl3a_

Details for d3rh0b_

PDB Entry: 3rh0, 1.72 Å

PDB Description: Corynebacterium glutamicum mycothiol/mycoredoxin1-dependent arsenate reductase Cg_ArsC2

PDB Compounds: (B:) arsenate reductase

SCOPe Domain Sequences for d3rh0b_:

Sequence; same for both SEQRES and ATOM records:

>d3rh0b_ c.44.1.0 (B:) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
mksvlfvcvgnggksqmaaalaqkyasdsveihsagtkpaqglnqlsvesiaevgadmsq
gipkaidpellrtvdrvvilgddaqvdmpesaqgalerwsieepdaqgmermrivrdqid
nrvqallag

Timeline for d3rh0b_:

• d3rh0b_ first appeared in SCOPe 2.03
  
• d3rh0b_ appears in SCOPe 2.07