![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein CD1, beta2-microglobulin and alpha-3 domain [49130] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49131] (1 PDB entry) |
![]() | Domain d1cd1d_: 1cd1 D: [21582] Other proteins in same PDB: d1cd1a2, d1cd1c2 |
PDB Entry: 1cd1 (more details), 2.67 Å
SCOP Domain Sequences for d1cd1d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd1d_ b.1.1.2 (D:) CD1, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus)} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1cd1d_: