Lineage for d3rgdx_ (3rgd X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2700840Protein (Apo)ferritin [47246] (8 species)
  7. 2700841Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (21 PDB entries)
  8. 2700893Domain d3rgdx_: 3rgd X: [215818]
    Other proteins in same PDB: d3rgda_, d3rgdb_, d3rgdc_, d3rgdd_, d3rgde_, d3rgdj_, d3rgdk_, d3rgdl_, d3rgdm_, d3rgdo_, d3rgdp_, d3rgdq_, d3rgdu_, d3rgdv_, d3rgdw_
    automated match to d1mfra_
    complexed with fe

Details for d3rgdx_

PDB Entry: 3rgd (more details), 2.89 Å

PDB Description: iron loaded frog m ferritin. short soaking time
PDB Compounds: (X:) Ferritin, middle subunit

SCOPe Domain Sequences for d3rgdx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rgdx_ a.25.1.1 (X:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOPe Domain Coordinates for d3rgdx_:

Click to download the PDB-style file with coordinates for d3rgdx_.
(The format of our PDB-style files is described here.)

Timeline for d3rgdx_: