SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3rgds_ (3rgd S:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1988416Protein (Apo)ferritin [47246] (8 species)
  7. 1988417Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (17 PDB entries)
  8. 1988463Domain d3rgds_: 3rgd S: [215813]
    Other proteins in same PDB: d3rgda_, d3rgdb_, d3rgdc_, d3rgdd_, d3rgde_, d3rgdj_, d3rgdk_, d3rgdl_, d3rgdm_, d3rgdo_, d3rgdp_, d3rgdq_, d3rgdu_, d3rgdv_, d3rgdw_
    automated match to d1mfra_
    complexed with fe

Details for d3rgds_

PDB Entry: 3rgd (more details), 2.89 Å

PDB Description: Iron loaded frog M ferritin. Short soaking time
PDB Compounds: (S:) Ferritin, middle subunit

SCOPe Domain Sequences for d3rgds_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rgds_ a.25.1.1 (S:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOPe Domain Coordinates for d3rgds_:

Click to download the PDB-style file with coordinates for d3rgds_.
(The format of our PDB-style files is described here.)

Timeline for d3rgds_: