| Class b: All beta proteins [48724] (119 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
| Protein CD1, beta2-microglobulin and alpha-3 domain [49130] (2 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [49131] (1 PDB entry) |
| Domain d1cd1c1: 1cd1 C:186-279 [21581] Other proteins in same PDB: d1cd1a2, d1cd1c2 |
PDB Entry: 1cd1 (more details), 2.67 Å
SCOP Domain Sequences for d1cd1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd1c1 b.1.1.2 (C:186-279) CD1, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus)}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d1cd1c1:
View in 3DDomains from other chains: (mouse over for more information) d1cd1a1, d1cd1a2, d1cd1b_, d1cd1d_ |