SCOPe 2.03: Domain d3rfzc2: 3rfz C:121-205

Lineage for d3rfzc2 (3rfz C:121-205)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.7: C2 domain-like [49561] (5 superfamilies)
   sandwich; 8 strands in 2 sheets; greek-key

4. Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families)

5. Family b.7.2.0: automated matches [227280] (1 protein)
   not a true family

6. Protein automated matches [227091] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226556] (2 PDB entries)

8. Domain d3rfzc2: 3rfz C:121-205 [215792]
   Other proteins in same PDB: d3rfza1, d3rfza2, d3rfzc1, d3rfzf1
   automated match to d1l4ia2
   complexed with so4

Details for d3rfzc2

PDB Entry: 3rfz, 2.8 Å

PDB Description: Crystal structure of the FimD usher bound to its cognate FimC:FimH substrate

PDB Compounds: (C:) chaperone protein fimc

SCOPe Domain Sequences for d3rfzc2:

Sequence, based on SEQRES records:

>d3rfzc2 b.7.2.0 (C:121-205) automated matches {Escherichia coli [TaxId: 562]}
alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsd
agsnityrtindygaltpkmtgvme

Sequence, based on observed residues (ATOM records):

>d3rfzc2 b.7.2.0 (C:121-205) automated matches {Escherichia coli [TaxId: 562]}
alppdqaaeklrfrrsansltlinptpyyltvtelnagtrvlenalvppmgesavklpsn
ityrtindygaltpkmtgvme

Timeline for d3rfzc2:

• d3rfzc2 is new in SCOPe 2.03-stable
  
• d3rfzc2 appears in SCOPe 2.04
  
• d3rfzc2 appears in the current release, SCOPe 2.08