Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (3 families) contains PP switch between strands D and C' |
Family b.1.11.1: Pilus chaperone [49355] (6 proteins) automatically mapped to Pfam PF00345 |
Protein automated matches [227064] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [226144] (1 PDB entry) |
Domain d3rfzc1: 3rfz C:1-120 [215791] Other proteins in same PDB: d3rfza1, d3rfza2, d3rfzc2, d3rfzf2 automated match to d1l4ia1 complexed with so4 |
PDB Entry: 3rfz (more details), 2.8 Å
SCOPe Domain Sequences for d3rfzc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rfzc1 b.1.11.1 (C:1-120) automated matches {Escherichia coli [TaxId: 562]} gvalgatrviypagqkqvqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
Timeline for d3rfzc1:
View in 3D Domains from other chains: (mouse over for more information) d3rfza1, d3rfza2, d3rfzf1, d3rfzf2 |