Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein CD1, beta2-microglobulin and alpha-3 domain [49130] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [49131] (1 PDB entry) |
Domain d1cd1a1: 1cd1 A:186-279 [21579] Other proteins in same PDB: d1cd1a2, d1cd1c2 |
PDB Entry: 1cd1 (more details), 2.67 Å
SCOP Domain Sequences for d1cd1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cd1a1 b.1.1.2 (A:186-279) CD1, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus)} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
Timeline for d1cd1a1:
View in 3D Domains from other chains: (mouse over for more information) d1cd1b1, d1cd1c1, d1cd1c2, d1cd1d1 |