Lineage for d3rfca2 (3rfc A:140-364)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979272Species Xanthomonas oryzae [TaxId:342109] [225705] (4 PDB entries)
  8. 2979273Domain d3rfca2: 3rfc A:140-364 [215789]
    Other proteins in same PDB: d3rfca1
    automated match to d1ehia2
    complexed with adp, mg

Details for d3rfca2

PDB Entry: 3rfc (more details), 2.1 Å

PDB Description: Crystal structure of D-alanine-D-alanine ligase A from Xanthomonas oryzae pathovar oryzae with ADP
PDB Compounds: (A:) D-alanine--D-alanine ligase 1

SCOPe Domain Sequences for d3rfca2:

Sequence, based on SEQRES records: (download)

>d3rfca2 d.142.1.0 (A:140-364) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvvhdafysyatk
yisehgaeivipadidaqtqqriqqiavqayqalgcagmarvdvflcadgrivinevntl
pgftrisvypklwqasgldyrglitrlielalerhtddqllrsav

Sequence, based on observed residues (ATOM records): (download)

>d3rfca2 d.142.1.0 (A:140-364) automated matches {Xanthomonas oryzae [TaxId: 342109]}
dkdmakrvlrdarlavapfvcfdrhtaahadvdtliaqlglplfvkpanqgssvgvsqvr
tadafaaalalalaydhkvlveaavagreiecavlgnavphasvcgevvveivipadida
qtqqriqqiavqayqalgcagmarvdvflcadgrivinevntlpgftrisvypklwqasg
ldyrglitrlielalerhtddqllrsav

SCOPe Domain Coordinates for d3rfca2:

Click to download the PDB-style file with coordinates for d3rfca2.
(The format of our PDB-style files is described here.)

Timeline for d3rfca2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3rfca1