Lineage for d3reva2 (3rev A:118-205)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750405Domain d3reva2: 3rev A:118-205 [215783]
    Other proteins in same PDB: d3reva1, d3revb1
    automated match to d1qrnd2
    complexed with edo

Details for d3reva2

PDB Entry: 3rev (more details), 2.2 Å

PDB Description: Crystal structure of human alloreactive tcr nb20
PDB Compounds: (A:) tcr nb20 alpha chain

SCOPe Domain Sequences for d3reva2:

Sequence, based on SEQRES records: (download)

>d3reva2 b.1.1.2 (A:118-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d3reva2 b.1.1.2 (A:118-205) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqkpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkfacanafnnsiipedtffp

SCOPe Domain Coordinates for d3reva2:

Click to download the PDB-style file with coordinates for d3reva2.
(The format of our PDB-style files is described here.)

Timeline for d3reva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3reva1