SCOPe 2.03: Domain d3reva1: 3rev A:3-117

Lineage for d3reva1 (3rev A:3-117)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)

8. Domain d3reva1: 3rev A:3-117 [215782]
   Other proteins in same PDB: d3reva2, d3revb1, d3revb2
   automated match to d1qrnd1
   complexed with edo

Details for d3reva1

PDB Entry: 3rev, 2.2 Å

PDB Description: Crystal structure of human alloreactive tcr nb20

PDB Compounds: (A:) tcr nb20 alpha chain

SCOPe Domain Sequences for d3reva1:

Sequence; same for both SEQRES and ATOM records:

>d3reva1 b.1.1.0 (A:3-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvaqpedqvnvaegnpltvkctysvsgnpylfwyvqypnrglqfllkyitgdnlvkgsy
gfeaefnksqtsfhlkkpsalvsdsalyfcavrdmnsgntplvfgkgtrlsvian

Timeline for d3reva1:

• d3reva1 is new in SCOPe 2.03-stable
  
• d3reva1 appears in SCOPe 2.04
  
• d3reva1 appears in the current release, SCOPe 2.08