Lineage for d3reva1 (3rev A:3-117)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755510Domain d3reva1: 3rev A:3-117 [215782]
    Other proteins in same PDB: d3reva2, d3revb1, d3revb2
    automated match to d1qrnd1
    complexed with edo

Details for d3reva1

PDB Entry: 3rev (more details), 2.2 Å

PDB Description: Crystal structure of human alloreactive tcr nb20
PDB Compounds: (A:) tcr nb20 alpha chain

SCOPe Domain Sequences for d3reva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3reva1 b.1.1.0 (A:3-117) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsvaqpedqvnvaegnpltvkctysvsgnpylfwyvqypnrglqfllkyitgdnlvkgsy
gfeaefnksqtsfhlkkpsalvsdsalyfcavrdmnsgntplvfgkgtrlsvian

SCOPe Domain Coordinates for d3reva1:

Click to download the PDB-style file with coordinates for d3reva1.
(The format of our PDB-style files is described here.)

Timeline for d3reva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3reva2