Lineage for d3reua_ (3reu A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920670Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)
  6. 1920896Protein automated matches [193659] (5 species)
    not a true protein
  7. 1920918Species Pyrococcus abyssi [TaxId:29292] [193660] (6 PDB entries)
  8. 1920927Domain d3reua_: 3reu A: [215780]
    automated match to d3p8vb_
    complexed with asp, atp, mg

Details for d3reua_

PDB Entry: 3reu (more details), 1.9 Å

PDB Description: Crystal structure of the archaeal asparagine synthetase A complexed with L-Aspartic acid and Adenosine triphosphate
PDB Compounds: (A:) AsnS-like asparaginyl-tRNA synthetase related protein

SCOPe Domain Sequences for d3reua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3reua_ d.104.1.1 (A:) automated matches {Pyrococcus abyssi [TaxId: 29292]}
mnaveiisrdiykaidiqtkildymtkfftdrgfkwllpimlspitdplwpdpagegirp
aevdvygvrmrlthsmilhkqlaiamglekifvlspnirlesrrkddgrhsyeftqldfe
iegakmkdvmrlieeliyglfrkaeewtgrefprarhfkvydykdileefgsdekasmem
eepfwivniprefydreengvwknydlilpygygevssggereweyekivakiraaglke
dsfrpyleiaragklkpsagagigverlvrfivgakhiaevqpfprvpgipavi

SCOPe Domain Coordinates for d3reua_:

Click to download the PDB-style file with coordinates for d3reua_.
(The format of our PDB-style files is described here.)

Timeline for d3reua_: