Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) |
Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins) |
Protein automated matches [193659] (5 species) not a true protein |
Species Pyrococcus abyssi [TaxId:29292] [193660] (6 PDB entries) |
Domain d3reua_: 3reu A: [215780] automated match to d3p8vb_ complexed with asp, atp, mg |
PDB Entry: 3reu (more details), 1.9 Å
SCOPe Domain Sequences for d3reua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3reua_ d.104.1.1 (A:) automated matches {Pyrococcus abyssi [TaxId: 29292]} mnaveiisrdiykaidiqtkildymtkfftdrgfkwllpimlspitdplwpdpagegirp aevdvygvrmrlthsmilhkqlaiamglekifvlspnirlesrrkddgrhsyeftqldfe iegakmkdvmrlieeliyglfrkaeewtgrefprarhfkvydykdileefgsdekasmem eepfwivniprefydreengvwknydlilpygygevssggereweyekivakiraaglke dsfrpyleiaragklkpsagagigverlvrfivgakhiaevqpfprvpgipavi
Timeline for d3reua_: